PDB entry 1sbr

View 1sbr on RCSB PDB site
Description: The structure and function of B. subtilis YkoF gene product: the complex with thiamin
Class: ligand binding protein
Keywords: YkoF, thiamin-binding protein, ACT-domain family, X-ray structure, LIGAND BINDING PROTEIN
Deposited on 2004-02-11, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34911
      • engineered (32-33)
    Domains in SCOPe 2.08: d1sbra_
  • Chain 'B':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34911
      • engineered (32-33)
    Domains in SCOPe 2.08: d1sbrb_
  • Heterogens: CA, VIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sbrA (A:)
    mehicgtsriagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbrA (A:)
    riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
    aanseqhivmngtfsigcpgdtqgdtylkrvnedavrglkaeapcqfalypmnepdymgl
    imeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansp
    sr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sbrB (B:)
    mehicgtsriagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbrB (B:)
    riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
    aanseqhivmngtfsigcpgdtqgdtylsdkrvnedavrglkaeapcqfalypmnepdym
    glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan
    sp