PDB entry 1sbk

View 1sbk on RCSB PDB site
Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.
Deposited on 2004-02-10, released 2004-02-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sbka_
  • Chain 'B':
    Domains in SCOP 1.69: d1sbkb_
  • Chain 'C':
    Domains in SCOP 1.69: d1sbkc_
  • Chain 'D':
    Domains in SCOP 1.69: d1sbkd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sbkA (A:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaillehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbkA (A:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaille
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sbkB (B:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaillehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbkB (B:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaille
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sbkC (C:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaillehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbkC (C:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaille
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sbkD (D:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaillehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbkD (D:)
    miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaille