PDB entry 1sbj

View 1sbj on RCSB PDB site
Description: NMR Structure of the Mg2+-loaded C Terminal Domain of Cardiac Troponin C Bound to the N Terminal Domain of Cardiac Troponin I
Class: contractile protein, structural protein
Keywords: troponin c-troponin I interaction, cardiac, muscle protein, 2 magnesium binding protein, contractile protein, structural protein
Deposited on 2004-02-10, released 2004-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Gallus gallus [TaxId:9031]
    Gene: cTnC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1sbja_
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sbjA (A:)
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve