PDB entry 1sbf

View 1sbf on RCSB PDB site
Description: soybean agglutinin
Class: lectin
Keywords: lectin, agglutinin
Deposited on 1997-10-21, released 1998-04-22
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: soybean agglutinin
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sbfa_
  • Heterogens: NAG, GAL, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sbfA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlphassnid
    pldltsfvlheai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbfA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph