PDB entry 1sbf

View 1sbf on RCSB PDB site
Description: soybean agglutinin
Deposited on 1997-10-21, released 1998-04-22
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-22, with a file datestamp of 1998-04-22.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sbf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbf_ (-)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph