PDB entry 1sbd

View 1sbd on RCSB PDB site
Description: soybean agglutinin complexed with 2,4-pentasaccharide
Deposited on 1995-07-13, released 1998-04-22
The last revision prior to the SCOP 1.67 freeze date was dated 1998-04-22, with a file datestamp of 1998-04-22.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1sbd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1sbd_ (-)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlphassnid
    pldltsfvlheai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbd_ (-)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenedqvva
    vefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyp
    sqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph