PDB entry 1sbb

View 1sbb on RCSB PDB site
Description: T-cell receptor beta chain complexed with superantigen seb
Class: immune system
Keywords: t cell receptor, superantigen, complex, immune system
Deposited on 1999-02-22, released 1999-03-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.228
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (14.3.d t cell antigen receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB U83243 (0-237)
      • engineered mutation (21)
      • engineered mutation (70)
      • insertion (95-97)
      • engineered mutation (116)
    Domains in SCOPe 2.05: d1sbba1, d1sbba2
  • Chain 'B':
    Compound: protein (staphylococcal enterotoxin b)
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sbbb1, d1sbbb2
  • Chain 'C':
    Compound: protein (14.3.d t cell antigen receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB U83243 (0-237)
      • engineered mutation (21)
      • engineered mutation (70)
      • insertion (95-97)
      • engineered mutation (116)
    Domains in SCOPe 2.05: d1sbbc1, d1sbbc2
  • Chain 'D':
    Compound: protein (staphylococcal enterotoxin b)
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sbbd1, d1sbbd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbbA (A:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbbB (B:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbbC (C:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sbbD (D:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbbD (D:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktshqtdkrktcmyggvtehngn
    qldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyet
    gyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk