PDB entry 1sb8

View 1sb8 on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa UDP-N-acetylglucosamine 4-epimerase complexed with UDP-N-acetylgalactosamine
Class: isomerase
Keywords: WbpP, epimerase, 4-epimerase, UDP-GalNAc, UDP-GlcNAc, SDR, GalE, NAD, SYK, pseudomonas aeruginosa, UDP, N-acetylglucosamine, N-acetylgalactosamine, UDP-Glc, ISOMERASE
Deposited on 2004-02-10, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wbpP
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: wbpP
    Database cross-references and differences (RAF-indexed):
    • GB AAM27817 (11-351)
    Domains in SCOPe 2.08: d1sb8a_
  • Heterogens: NAD, UD2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sb8A (A:)
    mhhhhhhgsmgmmsryeelrkelpaqpkvwlitgvagfigsnlletllkldqkvvgldnf
    atghqrnldevrslvsekqwsnfkfiqgdirnlddcnnacagvdyvlhqaalgsvprsin
    dpitsnatnidgflnmliaardakvqsftyaassstygdhpglpkvedtigkplspyavt
    kyvnelyadvfsrcygfstiglryfnvfgrrqdpngayaavipkwtssmiqgddvyingd
    getsrdfcyientvqanllaatagldarnqvyniavggrtslnqlffalrdglaengvsy
    hrepvyrdfregdvrhsladiskaakllgyapkydvsagvalampwyimflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb8A (A:)
    mmsryeelrkelpaqpkvwlitgvagfigsnlletllkldqkvvgldnfatghqrnldev
    rslvsekqwsnfkfiqgdirnlddcnnacagvdyvlhqaalgsvprsindpitsnatnid
    gflnmliaardakvqsftyaassstygdhpglpkvedtigkplspyavtkyvnelyadvf
    srcygfstiglryfnvfgrrqdpngayaavipkwtssmiqgddvyingdgetsrdfcyie
    ntvqanllaatagldarnqvyniavggrtslnqlffalrdglaengvsyhrepvyrdfre
    gdvrhsladiskaakllgyapkydvsagvalampwyimflk