PDB entry 1sb6

View 1sb6 on RCSB PDB site
Description: Solution structure of a cyanobacterial copper metallochaperone, ScAtx1
Class: chaperone
Keywords: copper chaperone, new metal binding motif, Structural Proteomics in Europe, SPINE, Structural Genomics, CHAPERONE
Deposited on 2004-02-10, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper chaperone ScAtx1
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sb6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sb6A (A:)
    mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasag
    heve