PDB entry 1say

View 1say on RCSB PDB site
Description: l-alanine dehydrogenase complexed with pyruvate
Class: oxidoreductase
Keywords: oxidoreductase, nad
Deposited on 1998-06-05, released 1999-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-alanine dehydrogenase
    Species: Phormidium lapideum [TaxId:32060]
    Gene: ALADH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1saya1, d1saya2
  • Heterogens: PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sayA (A:)
    meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
    akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
    lpnrslplltpmsiiagrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgt
    eaakmavglgaqvqifdinverlsyletlfgsrvellysnsaeietavaeadlligavlv
    pgrrapilvpaslveqmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnm
    pgavpwtatqalnnstlpyvvklanqglkaletddalakglnvqahrlvhpavqqvfpdl
    a