PDB entry 1sav

View 1sav on RCSB PDB site
Description: human annexin v with proline substitution by thioproline
Deposited on 1997-11-24, released 1998-05-27
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1sav__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1sav_ (-)
    qvlrgtvtdfxgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkxsrlydayelkhalkgagtnekvlteiiasrtxeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdxdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsixaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sav_ (-)
    qvlrgtvtdfgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
    dllddlkseltgkfeklivalmksrlydayelkhalkgagtnekvlteiiasrteelrai
    kqvyeeeygssleddvvgdtsgyyqrmlvvllqanrddagideaqveqdaqalfqagelk
    wgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvksirs
    iaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgdtsgd
    ykkallllcge