PDB entry 1sar

View 1sar on RCSB PDB site
Description: determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Class: hydrolase (endoribonuclease)
Keywords: hydrolase (endoribonuclease)
Deposited on 1990-12-13, released 1992-04-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sara_
  • Chain 'B':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sarb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sarA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sarB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc