PDB entry 1sap

View 1sap on RCSB PDB site
Description: hyperthermophile protein, relaxation matrix refinement structure
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1995-04-25, released 1995-09-15
The last revision prior to the SCOP 1.73 freeze date was dated 1995-09-15, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sac7d
    Species: Sulfolobus acidocaldarius
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sapa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sapA (A:)
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk