PDB entry 1sap

View 1sap on RCSB PDB site
Description: hyperthermophile protein, relaxation matrix refinement structure
Class: DNA binding protein
Keywords: DNA-binding protein, DNA binding protein
Deposited on 1995-04-25, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sac7d
  Species: Sulfolobus acidocaldarius [TaxId:2285]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (1-65)
  Domains in SCOPe 2.08: d1sapa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sapA (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk