PDB entry 1san

View 1san on RCSB PDB site
Description: the des(1-6)antennapedia homeodomain: comparison of the nmr solution structure and the DNA binding affinity with the intact antennapedia homeodomain
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1994-01-07, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antennapedia protein
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02833 (1-61)
    • conflict (33)
  Domains in SCOPe 2.06: d1sana_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sanA (A:)
  mtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkkenktkge
  pg