PDB entry 1sal

View 1sal on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sad structures)
Class: anti-oncogene
Keywords: anti-oncogene
Deposited on 1995-03-12, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.08: d1sala_
• Chain 'B':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.08: d1salb_
• Chain 'C':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.08: d1salc_
• Chain 'D':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.08: d1sald_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1salA (A:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1salB (B:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1salC (C:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1salD (D:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg