PDB entry 1sal

View 1sal on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sad structures)
Class: anti-oncogene
Keywords: anti-oncogene
Deposited on 1995-03-12, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sala_
  • Chain 'B':
    Compound: tumor suppressor p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1salb_
  • Chain 'C':
    Compound: tumor suppressor p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1salc_
  • Chain 'D':
    Compound: tumor suppressor p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sald_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1salA (A:)
    kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1salB (B:)
    kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1salC (C:)
    kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1salD (D:)
    kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg