PDB entry 1sa4

View 1sa4 on RCSB PDB site
Description: human protein farnesyltransferase complexed with FPP and R115777
Class: transferase
Keywords: ftase, farnesyltransferase, farnesyl transferase, caax, ras, cancer, tumor regression, r115777, tipifarnib, zarnestra, fti, clinical candidate, inhibitor, protein prenylation, lipid modification
Deposited on 2004-02-06, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sa4a_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sa4b_
  • Heterogens: SUC, ZN, FPP, JAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sa4A (A:)
    maategvgeaaqggepgqpaqpppqphppppqqqhkeemaaeageavaspmddgfvslds
    psyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrvlvewlr
    dpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnnsvwnqr
    yfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhstendsptnvqqeef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa4A (A:)
    fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
    lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
    svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sa4B (B:)
    maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
    pgfeelkdetsaepatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa4B (B:)
    sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
    rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
    speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
    vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
    glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
    lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
    hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe