PDB entry 1sa1

View 1sa1 on RCSB PDB site
Description: Tubulin-podophyllotoxin: stathmin-like domain complex
Class: cell cycle
Keywords: alpha-tubulin, beta-tubulin, colchicine, gtpase, microtubule podophyllotoxin, stathmin, tubulin, cell cycle
Deposited on 2004-02-06, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.206
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02550
      • see remark 999 (264)
    Domains in SCOPe 2.06: d1sa1a1, d1sa1a2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sa1b1, d1sa1b2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02550
      • see remark 999 (264)
    Domains in SCOPe 2.06: d1sa1c1, d1sa1c2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sa1d1, d1sa1d2
  • Chain 'E':
    Compound: Stathmin 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sa1e_
  • Heterogens: MG, GTP, GDP, POD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sa1A (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa1A (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsdgddsfntffsetgagkhvprav
    fvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkla
    dqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyn
    siltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdg
    alnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcd
    prhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpgg
    dlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedma
    alekdyeevgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sa1B (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa1B (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltqyraltvpeltqqmfdaknmmaacdpr
    hgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsat
    fignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyq
    da
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sa1C (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa1C (C:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsdsfntffsetgagkhvpravfvd
    leptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqc
    tglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsil
    tthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgaln
    vdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprh
    gkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdla
    kvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaale
    kdyeevgvds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sa1D (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa1D (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sa1E (E:)
    admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa1E (E:)
    mevielnkctsgqsfevilkppsfdgvpefnaslprrpsleeiqkkleaaeerrkyqeae
    llkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekd
    khaeevrknkelke