PDB entry 1sa0

View 1sa0 on RCSB PDB site
Description: tubulin-colchicine: stathmin-like domain complex
Deposited on 2004-02-06, released 2004-03-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: XRAY
Resolution: 3.58 Å
R-factor: 0.233
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sa0A (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa0A (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
    eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
    glqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
    thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnv
    dltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhg
    kymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlak
    vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
    dyeevgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sa0B (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa0B (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdaknmmaacdprhgr
    yltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
    nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sa0C (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa0C (C:)
    recisihvgqagvqignacwelyclehgiqpdgqmdsfntffsetgagkhvpravfvdle
    ptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqctg
    lqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsiltt
    httlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnvd
    ltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprhgkymacc
    llyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravc
    mlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevg
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sa0D (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa0D (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdaknmmaacdprhgr
    yltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
    nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sa0E (E:)
    admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sa0E (E:)
    admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
    hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
    elke