PDB entry 1s9v

View 1s9v on RCSB PDB site
Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide
Class: immune system
Keywords: immune system, hla-dq2
Deposited on 2004-02-05, released 2004-03-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ(3) alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s9va1, d1s9va2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ(1) beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s9vb1, d1s9vb2
  • Chain 'C':
    Compound: alpha-I gliadin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1S9V (0-10)
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ(3) alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s9vd1, d1s9vd2
  • Chain 'E':
    Compound: HLA class II histocompatibility antigen, DQ(1) beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s9ve1, d1s9ve2
  • Chain 'F':
    Compound: alpha-I gliadin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1S9V (0-10)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9vA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epeipapmselte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9vA (A:)
    vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt
    niavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnitw
    lsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9vB (B:)
    rdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaey
    wnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvt
    dfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpsl
    qspitvewraqsesaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9vB (B:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrnllvcsvtdfypaqikv
    rwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewr
    a
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s9vD (D:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epeipapmselte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9vD (D:)
    vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt
    niavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnitw
    lsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s9vE (E:)
    rdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaey
    wnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvt
    dfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpsl
    qspitvewraqsesaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9vE (E:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsnllvcsvtdfypaqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    

  • Chain 'F':
    No sequence available.