PDB entry 1s9u

View 1s9u on RCSB PDB site
Description: Atomic structure of a putative anaerobic dehydrogenase component
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, anaerobic dehydrogenases component, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-02-05, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.163
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative component of anaerobic dehydrogenases
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPK0 (3-206)
      • cloning artifact (0-2)
      • conflict (11)
    Domains in SCOPe 2.06: d1s9ua1, d1s9ua2
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9uA (A:)
    sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
    amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqf
    emqqnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqa
    lgqlarltlaqwqaqliipvavkplfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9uA (A:)
    sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
    amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqe
    pedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlar
    ltlaqwqaqliipvavkplfr