PDB entry 1s9u

View 1s9u on RCSB PDB site
Description: Atomic structure of a putative anaerobic dehydrogenase component
Deposited on 2004-02-05, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.163
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s9ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9uA (A:)
    sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
    amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqf
    emqqnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqa
    lgqlarltlaqwqaqliipvavkplfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9uA (A:)
    sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
    amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqe
    pedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlar
    ltlaqwqaqliipvavkplfr