PDB entry 1s9r

View 1s9r on RCSB PDB site
Description: crystal structure of arginine deiminase covalently linked with a reaction intermediate
Deposited on 2004-02-05, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s9ra_
  • Chain 'B':
    Domains in SCOP 1.67: d1s9rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9rA (A:)
    msvfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkq
    fvaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflka
    kktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvr
    qretlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtl
    laknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlv
    nggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgv
    vigysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9rA (A:)
    svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
    vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
    ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
    retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
    aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
    ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
    igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9rB (B:)
    msvfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkq
    fvaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflka
    kktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvr
    qretlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtl
    laknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlv
    nggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgv
    vigysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9rB (B:)
    svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
    vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
    ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
    retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
    aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
    ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
    igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw