PDB entry 1s9k

View 1s9k on RCSB PDB site
Description: Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site
Class: transcription/DNA
Keywords: Beta Barrel, Protein-DNA Complex, Double Helix, Ternary, Complex, B-ZIP, Basic Leucine Zipper, Coiled Coil
Deposited on 2004-02-04, released 2005-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.242
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human IL-2 ARRE1 Promoter Element, Plus Strand
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: Human IL-2 ARRE1 Promoter Element, Minus Strand
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: HOMO SAPIENS
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s9kc1, d1s9kc2
  • Chain 'D':
    Compound: Proto-oncogene protein c-fos
    Species: HOMO SAPIENS
    Gene: FOS, G0S7
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription factor AP-1
    Species: HOMO SAPIENS
    Gene: JUN
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s9kC (C:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsahelp
    mverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnml
    fveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.