PDB entry 1s9j

View 1s9j on RCSB PDB site
Description: X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a complex with ligand and MgATP
Class: transferase
Keywords: PROTEIN KINASE-LIGAND-MgATP COMPLEX, PROTEIN-PROTEIN INTERACTIONS
Deposited on 2004-02-04, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.246
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: HOMO SAPIENS
    Gene: MEK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1s9ja_
  • Heterogens: MG, ATP, BBM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9jA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnqpstpthaagvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9jA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmavgtrsymsperlqgthysvq
    sdiwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfsle
    fqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln