PDB entry 1s9d

View 1s9d on RCSB PDB site
Description: arf1[delta 1-17]-GDP-mg in complex with brefeldin a and a sec7 domain
Class: protein transport/exchange factor
Keywords: PROTEIN TRANSPORT/EXCHANGE FACTOR, PROTEIN TRANSPORT-EXCHANGE FACTOR complex
Deposited on 2004-02-04, released 2004-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Bos taurus [TaxId:9913]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s9da_
  • Chain 'E':
    Compound: arno
    Species: Homo sapiens [TaxId:9606]
    Gene: PSCD2, ARNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418
      • modified residue (124)
      • engineered (140-141)
      • engineered (148)
      • engineered (158)
    Domains in SCOPe 2.06: d1s9de_
  • Heterogens: MG, GDP, AFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9dA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9dA (A:)
    mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq
    ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaaeitdkl
    glhslrhrnwyiqatcatsgdglyegldwlsnqlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s9dE (E:)
    leanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkt
    aigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaq
    ryclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpee
    llrnlydsirnepfkipeddgnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9dE (E:)
    ktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylg
    ereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcnp
    gvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlyd
    sirnepfkipedd