PDB entry 1s9a

View 1s9a on RCSB PDB site
Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp
Deposited on 2004-02-04, released 2004-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s9aa_
  • Chain 'B':
    Domains in SCOP 1.71: d1s9ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9aA (A:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9aA (A:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9aB (B:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9aB (B:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn