PDB entry 1s9a

View 1s9a on RCSB PDB site
Description: Crystal Structure of 4-Chlorocatechol 1,2-dioxygenase from Rhodococcus opacus 1CP
Class: oxidoreductase
Keywords: beta barrel, OXIDOREDUCTASE
Deposited on 2004-02-04, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4699999999999998 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s9aa_
  • Chain 'B':
    Compound: Chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s9ab_
  • Heterogens: FE, HGP, TAM, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9aA (A:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9aA (A:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9aB (B:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9aB (B:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn