PDB entry 1s98

View 1s98 on RCSB PDB site
Description: E.coli IscA crystal structure to 2.3 A
Class: metal transport
Keywords: IscA, Fe-S cluster, iron, sulfur, Isc, METAL TRANSPORT
Deposited on 2004-02-03, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yfhF
    Species: Escherichia coli [TaxId:562]
    Gene: YFHF, B2528, C3053, Z3795, ECS3394, SF2575, S2747
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AAC8
      • engineered (68)
    Domains in SCOPe 2.07: d1s98a_
  • Chain 'B':
    Compound: Protein yfhF
    Species: Escherichia coli [TaxId:562]
    Gene: YFHF, B2528, C3053, Z3795, ECS3394, SF2575, S2747
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AAC8
      • engineered (68)
    Domains in SCOPe 2.07: d1s98b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s98A (A:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgksmqfldgtqldfvkeglnegfkftnpnvkdecgcgesfhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s98A (A:)
    sitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgvk
    vvvdgksmqfldgtqldfvkeglnegfkftnpnvkde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s98B (B:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgksmqfldgtqldfvkeglnegfkftnpnvkdecgcgesfhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s98B (B:)
    sitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgvk
    vvvdgksmqfldgtqldfvkeglnegfkftnpnvkde