PDB entry 1s96

View 1s96 on RCSB PDB site
Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli
Class: transferase
Keywords: X-ray Structure, guanylate kinase, E.coli, dimer, SAD, transferase
Deposited on 2004-02-03, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: GMK, SPOR, B3648, C4473, SF3688, S4081
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60546 (Start-218)
      • modified residue (76)
      • modified residue (126)
      • modified residue (161)
      • modified residue (168)
      • modified residue (201)
    Domains in SCOPe 2.07: d1s96a_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: GMK, SPOR, B3648, C4473, SF3688, S4081
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60546
      • modified residue (76)
      • modified residue (126)
      • modified residue (161)
      • modified residue (168)
      • modified residue (201)
    Domains in SCOPe 2.07: d1s96b_
  • Heterogens: PO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s96A (A:)
    mgsdkihhhhhhmaqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpge
    vhgehyffvnhdefkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqga
    qqirqkmpharsifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydyliv
    nddfdtaltdlktiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s96A (A:)
    qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
    kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
    ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
    iraerlrmsrqkqrhdaliskllad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s96B (B:)
    mgsdkihhhhhhmaqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpge
    vhgehyffvnhdefkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqga
    qqirqkmpharsifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydyliv
    nddfdtaltdlktiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s96B (B:)
    qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
    kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
    ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
    iraerlrmsrqkqrhdalisklla