PDB entry 1s96

View 1s96 on RCSB PDB site
Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli
Deposited on 2004-02-03, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s96a_
  • Chain 'B':
    Domains in SCOP 1.67: d1s96b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s96A (A:)
    mgsdkihhhhhhmaqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpge
    vhgehyffvnhdefkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqga
    qqirqkmpharsifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydyliv
    nddfdtaltdlktiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s96A (A:)
    qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
    kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
    ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
    iraerlrmsrqkqrhdaliskllad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s96B (B:)
    mgsdkihhhhhhmaqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpge
    vhgehyffvnhdefkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqga
    qqirqkmpharsifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydyliv
    nddfdtaltdlktiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s96B (B:)
    qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
    kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
    ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
    iraerlrmsrqkqrhdalisklla