PDB entry 1s94

View 1s94 on RCSB PDB site
Description: Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei
Class: endocytosis/exocytosis
Keywords: three helix bundle, structural plasticity, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2004-02-03, released 2004-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.34 Å
R-factor: 0.313
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-syntaxin
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s94a_
  • Chain 'B':
    Compound: s-syntaxin
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s94b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s94A (A:)
    mrgsprtkdrlaalkaavsdeedveevavqvdsgggfmeeffeqveeiramidkisdnvd
    avkkkhsdilsapqtddqmkeeleelmtdikrtankvrgklktielnieqeehsnkssad
    lrirktqystisrkfvevmsdynttqidyrdrckarikrqmeitgrtttneeledmlesg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s94A (A:)
    gfmeeffeqveeiramidkisdnvdavkkkhsdilsmkeeleelmtdikrtankvrgklk
    tielnieqeesadlrirktqystisrkfvevmsdynttqidyrdrckar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s94B (B:)
    mrgsprtkdrlaalkaavsdeedveevavqvdsgggfmeeffeqveeiramidkisdnvd
    avkkkhsdilsapqtddqmkeeleelmtdikrtankvrgklktielnieqeehsnkssad
    lrirktqystisrkfvevmsdynttqidyrdrckarikrqmeitgrtttneeledmlesg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s94B (B:)
    fmeeffeqveeiramidkisdnvdavkkkhsdilsapqtddqmkeeleelmtdikrtank
    vrgklktielnieqsadlrirktqystisrkfvevmsdynttqidyrdrckarikrqm