PDB entry 1s8o

View 1s8o on RCSB PDB site
Description: Human soluble Epoxide Hydrolase
Class: Hydrolase
Keywords: domain-swapped dimer, Hydrolase
Deposited on 2004-02-03, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxide hydrolase 2, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s8oa1, d1s8oa2
  • Heterogens: P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s8oA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s8oA (A:)
    raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw
    iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt
    ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl
    ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgyvt
    vkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessapp
    eieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntpfi
    panpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhkvc
    eagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslgrk
    ilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikwld
    sdarn