PDB entry 1s8h

View 1s8h on RCSB PDB site
Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, first fatty acid free form
Deposited on 2004-02-02, released 2004-02-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s8ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s8hA (A:)
    sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
    tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
    c