PDB entry 1s8h

View 1s8h on RCSB PDB site
Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, first fatty acid free form
Class: hydrolase, toxin
Keywords: Lys49-Phospholipase A2, snake venom, myotoxicity, fatty acid free form, hydrolase, toxin
Deposited on 2004-02-02, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog
    Species: Agkistrodon contortrix laticinctus [TaxId:37195]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s8ha_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s8hA (A:)
    sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
    tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
    c