PDB entry 1s8f

View 1s8f on RCSB PDB site
Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II
Class: protein transport
Keywords: intracellular transport, vesicular trafficking, hemihedral twinning, PROTEIN TRANSPORT
Deposited on 2004-02-02, released 2004-06-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.165
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-9A
    Species: Canis lupus [TaxId:9615]
    Gene: RAB9A, RAB9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s8fa_
  • Chain 'B':
    Compound: Ras-related protein Rab-9A
    Species: Canis lupus [TaxId:9615]
    Gene: RAB9A, RAB9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24408 (1-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1s8fb1, d1s8fb2
  • Heterogens: SR, MG, CL, GDP, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s8fA (A:)
    gamagksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtm
    qiwdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfp
    fvilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s8fA (A:)
    sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
    gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvpesfpfvilgnki
    diserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s8fB (B:)
    gamagksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtm
    qiwdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfp
    fvilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s8fB (B:)
    gamagksslfkvillgdggvgksslmnryvtnkfdlfhtigveflnkdlevdghfvtmqi
    wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
    ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl