PDB entry 1s8e

View 1s8e on RCSB PDB site
Description: Crystal structure of Mre11-3
Class: replication
Keywords: DNA double-strand break, Mre11, Rad50, REPLICATION
Deposited on 2004-02-02, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.231
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exonuclease putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (1-332)
      • initiating methionine (0)
      • engineered (84-85)
    Domains in SCOPe 2.07: d1s8ea_
  • Chain 'B':
    Compound: exonuclease putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (1-332)
      • initiating methionine (0)
      • engineered (84-85)
    Domains in SCOPe 2.07: d1s8eb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s8eA (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwri
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s8eB (B:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwri