PDB entry 1s80

View 1s80 on RCSB PDB site
Description: Structure of Serine Acetyltransferase from Haemophilis influenzae Rd
Class: transferase
Keywords: Structural Genomics; Protein Structure Initiative; Serine Acetyltransferase; Left-Handed Parallel beta-Helix; NYSGXRC, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2004-01-30, released 2004-08-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80a_
  • Chain 'B':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80b_
  • Chain 'C':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80c_
  • Chain 'D':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80d_
  • Chain 'E':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80e_
  • Chain 'F':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (1-End)
      • cloning artifact (1-2)
      • modified residue (23)
      • modified residue (55)
      • modified residue (152)
      • modified residue (198)
    Domains in SCOPe 2.05: d1s80f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s80A (A:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80A (A:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s80B (B:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80B (B:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s80C (C:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80C (C:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s80D (D:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80D (D:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s80E (E:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80E (E:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s80F (F:)
    msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpais
    lreiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwn
    qnrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtl
    ggtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpar
    ivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s80F (F:)
    sltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaisl
    reiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnq
    nrkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlg
    gtgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpari
    v