PDB entry 1s7z

View 1s7z on RCSB PDB site
Description: Structure of Ocr from Bacteriophage T7
Class: gene regulation
Keywords: all helical, gene regulation
Deposited on 2004-01-30, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.173
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gene 0.3 protein
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 0.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03775
      • modified residue (5)
      • modified residue (17)
      • modified residue (39)
      • modified residue (56)
      • modified residue (71)
    Domains in SCOPe 2.07: d1s7za_
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1s7zA (A:)
mamsnmtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmase
gidlefedsglmpdtkdvirilqariyeqltidlwedaedllneyleeveeyeedee

    Sequence, based on observed residues (ATOM records): (download) 
    >1s7zA (A:)
mtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmasegidle
fedsglmpdtkdvirilqariyeqltidlwedaedllneyleevee