PDB entry 1s7z
View 1s7z on RCSB PDB site
Description: Structure of Ocr from Bacteriophage T7
Class: gene regulation
Keywords: all helical, gene regulation
Deposited on
2004-01-30, released
2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.173
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Gene 0.3 protein
Species: Enterobacteria phage T7 [TaxId:10760]
Gene: 0.3
Database cross-references and differences (RAF-indexed):
- Uniprot P03775
- modified residue (5)
- modified residue (17)
- modified residue (39)
- modified residue (56)
- modified residue (71)
Domains in SCOPe 2.07: d1s7za_ - Heterogens: CS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1s7zA (A:)
mamsnmtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmase
gidlefedsglmpdtkdvirilqariyeqltidlwedaedllneyleeveeyeedee
Sequence, based on observed residues (ATOM records): (download)
>1s7zA (A:)
mtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmasegidle
fedsglmpdtkdvirilqariyeqltidlwedaedllneyleevee