PDB entry 1s7w

View 1s7w on RCSB PDB site
Description:
Deposited on 2004-01-30, released 2004-05-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wa1, d1s7wa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wb_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wd1, d1s7wd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7we_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wg1, d1s7wg2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wh_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wj1, d1s7wj2
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1s7wk_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7wA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwepppstdsymvivavlgvlgamaiig
    avvafvmkrrrntggkggdyalapgsqssemslrdcka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7wA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7wB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7wB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s7wD (D:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwepppstdsymvivavlgvlgamaiig
    avvafvmkrrrntggkggdyalapgsqssemslrdcka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7wD (D:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s7wE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s7wG (G:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwepppstdsymvivavlgvlgamaiig
    avvafvmkrrrntggkggdyalapgsqssemslrdcka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7wG (G:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s7wH (H:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s7wJ (J:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwepppstdsymvivavlgvlgamaiig
    avvafvmkrrrntggkggdyalapgsqssemslrdcka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7wJ (J:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s7wK (K:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm