PDB entry 1s7o

View 1s7o on RCSB PDB site
Description: Crystal structure of putative DNA binding protein SP_1288 from Streptococcus pygenes
Class: structural genomics, unknown function
Keywords: Putative DNA binding protein; structural genomics, Signal recognition particle, RNA polymerase Sigma Factor, X-Rat crystallography, UPF0122, structure funded by NIH, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-01-29, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM18_1152
    Species: Streptococcus pyogenes [TaxId:301448]
    Gene: SPY1201, SPYM3_0842, SPS1042, SPYM18_1152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s7oa_
  • Chain 'B':
    Compound: Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM18_1152
    Species: Streptococcus pyogenes [TaxId:301448]
    Gene: SPY1201, SPYM3_0842, SPS1042, SPYM18_1152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s7ob_
  • Chain 'C':
    Compound: Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM18_1152
    Species: Streptococcus pyogenes [TaxId:301448]
    Gene: SPY1201, SPYM3_0842, SPS1042, SPYM18_1152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s7oc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7oA (A:)
    mnimeiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnik
    rtekiletyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7oA (A:)
    ektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtekil
    etyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7oB (B:)
    mnimeiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnik
    rtekiletyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7oB (B:)
    iektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrteki
    letyemklhmysdyvvrseifddmiahyphdeylqekisiltsid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s7oC (C:)
    mnimeiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnik
    rtekiletyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7oC (C:)
    eiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtek
    iletyemklhmysdyvvrseifddmiahyphdeylqekisiltsidnr