PDB entry 1s7n

View 1s7n on RCSB PDB site
Description: Ribosomal L7/L12 alpha-N-protein acetyltransferase in complex with Coenzyme A (CoA free sulfhydryl)
Class: transferase
Keywords: acetyltransferase, GNAT, alpha-N-protein acetyltransferase, Coenzyme A, L7/L12
Deposited on 2004-01-29, released 2005-03-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl transferase
    Species: Salmonella typhimurium LT2
    Gene: RimL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s7na1
  • Chain 'B':
    Compound: acetyl transferase
    Species: Salmonella typhimurium LT2
    Gene: RimL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s7nb1
  • Chain 'C':
    Compound: acetyl transferase
    Species: Salmonella typhimurium LT2
    Gene: RimL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s7nc1
  • Chain 'D':
    Compound: acetyl transferase
    Species: Salmonella typhimurium LT2
    Gene: RimL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s7nd1
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7nA (A:)
    gshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqg
    nillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqal
    mthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7nA (A:)
    veiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnill
    hqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthy
    arrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariida
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7nB (B:)
    gshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqg
    nillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqal
    mthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7nB (B:)
    mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
    lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
    yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s7nC (C:)
    gshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqg
    nillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqal
    mthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7nC (C:)
    eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
    qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
    rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariida
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s7nD (D:)
    gshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqg
    nillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqal
    mthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7nD (D:)
    eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
    qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
    rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad