PDB entry 1s7m

View 1s7m on RCSB PDB site
Description: Crystal Structure of HiaBD1
Class: cell adhesion
Keywords: adhesion, homotrimer, autotransporter, CELL ADHESION
Deposited on 2004-01-29, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7ma_
  • Chain 'B':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7mb_
  • Chain 'C':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7mc_
  • Chain 'D':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7md_
  • Chain 'E':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7me_
  • Chain 'F':
    Compound: Hia
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s7mf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7mA (A:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mA (A:)
    gakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplt
    ssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggst
    eyhdqvrnanevkfksgnginvsgktvngrreitfela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7mB (B:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mB (B:)
    akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
    sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
    yhdqvrnanevkfksgnginvsgktvngrreitfela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s7mC (C:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mC (C:)
    kteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdpltss
    adnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggstey
    hdqvrnanevkfksgnginvsgktvngrreitfelak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s7mD (D:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mD (D:)
    akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
    sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
    yhdqvrnanevkfksgnginvsgktvngrreitfelak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s7mE (E:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mE (E:)
    akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
    sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
    yhdqvrnanevkfksgnginvsgktvngrreitfela
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s7mF (F:)
    tlgtgnngakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgd
    anfdpltssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisad
    kttggsteyhdqvrnanevkfksgnginvsgktvngrreitfelakgevvksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7mF (F:)
    akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
    sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
    yhdqvrnanevkfksgnginvsgktvngrreitfela