PDB entry 1s7k

View 1s7k on RCSB PDB site
Description: RimL- Ribosomal L7/L12 alpha-N-protein acetyltransferase crystal form 2 (apo)
Class: transferase
Keywords: acetyltransferase, GNAT, alpha-N-protein acetyltransferase, Coenzyme A, L7/L12, transferase
Deposited on 2004-01-29, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: RimL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7ka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7kA (A:)
    gshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqg
    nillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqal
    mthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7kA (A:)
    eiipvsttlelraadeshvpalhqlvlkntrkhvqgnillhqrgyakmylifcqnemagv
    lsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrgdirrfvikcrvdnqas
    navarrnhftlegcmkqaeylngdyhdvnmyariidad