PDB entry 1s7j

View 1s7j on RCSB PDB site
Description: crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)
Deposited on 2004-01-29, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s7ja_
  • Chain 'B':
    Domains in SCOP 1.67: d1s7jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7jA (A:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeaylpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7jA (A:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeayl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7jB (B:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeaylpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7jB (B:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeayl