PDB entry 1s7j

View 1s7j on RCSB PDB site
Description: Crystal structure of phenazine biosynthesis protein PhzF family (Enterococcus faecalis)
Class: biosynthetic protein
Keywords: phenazine, biosynthesis, bacteria, enterococcus, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, BIOSYNTHETIC PROTEIN
Deposited on 2004-01-29, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenazine biosynthesis protein PhzF family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7ja_
  • Chain 'B':
    Compound: phenazine biosynthesis protein PhzF family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7jA (A:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeaylpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7jA (A:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeayl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7jB (B:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeaylpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7jB (B:)
    msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
    wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
    eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
    gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
    enrviiggtaklfakgeayl