PDB entry 1s7i

View 1s7i on RCSB PDB site
Description: 1.8 A Crystal Structure of a Protein of Unknown Function PA1349 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: Structural Genomics, protein structure initiative, Pseudomonas aeruginosa, MCSG, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-01-29, released 2004-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein PA1349
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9I3Z5 (6-121)
    • cloning artifact (0-5)
    • cloning artifact (122-123)
  Domains in SCOPe 2.06: d1s7ia1, d1s7ia2, d1s7ia3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s7iA (A:)
  lyfqgnmkylcliyfdeaklaavpaeelaaivdecmtysdqlgkaghyiashalqsvqta
  ttlrhqggrlamtdgpfaetkeqlggfylieardlnqalqiaakippgrlgcvevrpvke
  wegs