PDB entry 1s7f

View 1s7f on RCSB PDB site
Description: RimL- Ribosomal L7/L12 alpha-N-protein acetyltransferase crystal form I (apo)
Class: transferase
Keywords: acetyltransferase, GNAT, alpha-N-protein acetyltransferase, Coenzyme A, L7/L12, TRANSFERASE
Deposited on 2004-01-29, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: RimL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPC0 (20-End)
      • expression tag (12-19)
    Domains in SCOPe 2.08: d1s7fa1, d1s7fa2
  • Heterogens: CL, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7fA (A:)
    mgsshhhhhhssglvprgshmveiipvsttlelraadeshvpalhqlvlknkawlqqsld
    wpqyvtsqeetrkhvqgnillhqrgyakmylifcqnemagvlsfnaiepinkaayigywl
    desfqgqgimsqslqalmthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqae
    ylngdyhdvnmyariidad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7fA (A:)
    glvprgshmveiipvsttlelraadeshvpalhqlvlknkawlqqsldwptsqeetrkhv
    qgnillhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslq
    almthyarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyari
    i