PDB entry 1s7e

View 1s7e on RCSB PDB site
Description: Solution structure of HNF-6
Class: transcription
Keywords: Transcription regulation, Homeobox, DNA-binding, Nuclear protein
Deposited on 2004-01-29, released 2004-12-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hepatocyte nuclear factor 6
  Species: Mus musculus
  Gene: rpoD
  Database cross-references and differences (RAF-indexed):
  • Uniprot O08755 (0-146)
  Domains in SCOP 1.75: d1s7ea1, d1s7ea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s7eA (A:)
  eintkevaqrittelkrysipqaifaqrvlcrsqgtlsdllrnpkpwsklksgretfrrm
  wkwlqepefqrmsalrlaackrkeqehgkdrgntpkkprlvftdvqrrtlhaifkenkrp
  skelqitisqqlglelstvsnffmnar