PDB entry 1s7d

View 1s7d on RCSB PDB site
Description: Crystal structure of refined tetragonal crystal of YodA from Escherichia coli
Class: structural genomics
Keywords: hypothetical, structural genomics, x-ray crytsallography, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center
Deposited on 2004-01-29, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal-binding protein yodA
    Species: Escherichia coli [TaxId:562]
    Gene: yodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s7da_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7dA (A:)
    mairlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdg
    vwqsvypllqsgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrn
    nettsckydydgykiltyksgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhif
    mgndsqqsllnemenwptyypyqlsseevveemmsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7dA (A:)
    gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
    faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
    eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
    veemmsh